PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016469435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 492aa    MW: 56500 Da    PI: 9.2318
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016469435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.36.4e-14341111098
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +k+  l +p  f+ ++ ++ + +++  +  + +++W vk+  ++++    l++GW++F+++++L+ gD++vF ++g++ef   v++f 
  XP_016469435.1  34 GFKN-GLKIPLGFL-KYRKD-HDHIEHAILRRGSKKWLVKV--NGRR----LEEGWEKFAEEHNLQLGDILVFGHEGDMEF--EVSIFH 111
                     4555.5********.88555.46788999999*********..8888....************************999999..888875 PP

2B353.35.1e-17196282596
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +++++  +++++ +pk fa+e+g+++++  t++++d + rsWe++l    + +++++++ W++F+ an LkegD v+F+  + +++++ +k+
  XP_016469435.1 196 TVKPYWISKCLMHVPKLFARENGLSNRK-CTIVIRD-EQRSWEFRL--YSSARSIFIGGEWRKFCAANFLKEGDHVMFEIFS-KGEKPILKF 282
                     56788999**************999765.5999999.779******..999999*************************654.677777765 PP

3B352.31e-16341421587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     +++++ l+ g l +pk+fa+++g+k + +  l+++de+ +sW+++l  + ++ ++++++G ++F  +n LkegD ++F+ + +
  XP_016469435.1 341 TIRPYCLTYGFLNIPKHFASANGLKANMKCSLIIRDERQKSWTLRL--SVCKTQVYIGDGLRKFIADNCLKEGDRIMFETVTN 421
                     5678999999************999999999***************..999999*************************6653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-1919115IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-1921115IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.88524113IPR003340B3 DNA binding domain
CDDcd100174.57E-1325110No hitNo description
SMARTSM010192.1E-1527113IPR003340B3 DNA binding domain
PfamPF023622.0E-1034111IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-16190282IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-17190282IPR015300DNA-binding pseudobarrel domain
CDDcd100175.17E-14191284No hitNo description
PROSITE profilePS5086311.914192286IPR003340B3 DNA binding domain
SMARTSM010191.2E-14192286IPR003340B3 DNA binding domain
PfamPF023625.0E-15195283IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.7E-18335429IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-17335429IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.1E-16337432IPR003340B3 DNA binding domain
PROSITE profilePS5086310.785337432IPR003340B3 DNA binding domain
PfamPF023622.3E-14341423IPR003340B3 DNA binding domain
CDDcd100171.92E-11350417No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MEKMRGDMMI EMKEMTAMKI PPKKPHFFKP IMPGFKNGLK IPLGFLKYRK DHDHIEHAIL  60
RRGSKKWLVK VNGRRLEEGW EKFAEEHNLQ LGDILVFGHE GDMEFEVSIF HSNQCEREYE  120
EEQKVHNVEE TSKKFEFKDL RGNASLLPEG KKTNLHAKSV STEEKTNPNI MSSHEVFPDV  180
EATKDMPLGH PHVITTVKPY WISKCLMHVP KLFARENGLS NRKCTIVIRD EQRSWEFRLY  240
SSARSIFIGG EWRKFCAANF LKEGDHVMFE IFSKGEKPIL KFYNLRGNAS LQPGGKTTNL  300
HAKRVSSEEK SSPSIKSSNK ASTDAKVAAH KPYGHSNFVC TIRPYCLTYG FLNIPKHFAS  360
ANGLKANMKC SLIIRDERQK SWTLRLSVCK TQVYIGDGLR KFIADNCLKE GDRIMFETVT  420
NGETPIWKFQ VVTSGKDSDE GSIKNIGDVL EPRIFTENFE NVYNFISYTK SCTLLVNFDS  480
IKIYLSMLAD TD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016469435.10.0PREDICTED: B3 domain-containing protein REM5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.12e-35B3 family protein